Our greeting cards pair up nostalgic images with fun quotes for a modern, quirky style! Retailers can buy most items in sets of 3 or 6 with just a $50 minimum. See details on the Wholesale page. FRANKLY SPEAKING VINTAGE GREETINGS! Mom and Dad Day.
http://www.franklyspeakingvintagegreetings.com/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Tuesday
LOAD TIME
0.4 seconds
16x16
32x32
64x64
128x128
160x160
192x192
Frankly Speaking Vintage Greetings
Julie Frank
312 W. ●●●●●●●. #1012
Los ●●●●eles , California, 90013
United States
View this contact
Frankly Speaking Vintage Greetings
Julie Frank
312 W. ●●●●●●●. #1012
Los ●●●●eles , California, 90013
United States
View this contact
Frankly Speaking Vintage Greetings
Julie Frank
312 W. ●●●●●●●. #1012
Los ●●●●eles , California, 90013
United States
View this contact
BUY YOUR DOMAIN
10
YEARS
0
MONTHS
4
DAYS
GODADDY.COM, LLC
WHOIS : whois.godaddy.com
REFERRED : http://registrar.godaddy.com
PAGES IN
THIS WEBSITE
12
SSL
EXTERNAL LINKS
11
SITE IP
54.236.189.61
LOAD TIME
0.435 sec
SCORE
6.2
HomeFrankly Speaking Vintage Greeting Cards | franklyspeakingvintagegreetings.com Reviews
https://franklyspeakingvintagegreetings.com
Our greeting cards pair up nostalgic images with fun quotes for a modern, quirky style! Retailers can buy most items in sets of 3 or 6 with just a $50 minimum. See details on the Wholesale page. FRANKLY SPEAKING VINTAGE GREETINGS! Mom and Dad Day.
franklyspeakingvintagegreetings.com
WholesaleFrankly Speaking Vintage Greeting Cards
http://www.franklyspeakingvintagegreetings.com/wholesale.html
It would be our pleasure to service your account with us in any way possible, including switching out cards, replacing worn envelopes, and finding what works for your store. We are a small business that thrives on support from our local community! In return, we are able to support our customers with a more unique product and offer them personal service. If your store is in the Los Angeles area, we can take your order in person, just give us a call. Display ideas and Card Pricing.
Belles Visions CardsFrankly Speaking Vintage Greeting Cards
http://www.franklyspeakingvintagegreetings.com/belles-visions-cards.html
Collages are original &. Just to make sending a note. Of thanks more unusual and fun! 2014 FRANKLY SPEAKING VINTAGE GREETINGS.
Get WellFrankly Speaking Vintage Greeting Cards
http://www.franklyspeakingvintagegreetings.com/get-well.html
Welcome to our on-line store!
New BabyFrankly Speaking Vintage Greeting Cards
http://www.franklyspeakingvintagegreetings.com/new-baby.html
Welcome to our on-line store!
About UsFrankly Speaking Vintage Greeting Cards
http://www.franklyspeakingvintagegreetings.com/about-us.html
Hen unexpected circumstances bring people together, sometimes they see things they didn’t see before. When similar interests are discussed, and backgrounds seem to compliment and support a rising idea, a new partnership can form. This is (frankly) what happened to two sisters (in-law), Annie and Julie Frank, when they decided to start a new company. Frankly Speaking Vintage Greetings with Something to Say .
TOTAL PAGES IN THIS WEBSITE
12
franklyspeakingvintagegreetings.blogspot.com
Frankly Speaking Modern Vintage Blogspot: November 2010
http://franklyspeakingvintagegreetings.blogspot.com/2010_11_01_archive.html
Remixing, remaking, and recycling great vintage imagery. Monday, November 22, 2010. Although no one knows for sure when a camera-type device was first discovered, the. Became popular among R. Artists who used it to trace the image projected by light shining through a tiny hole. The year the invention of the photographic process was made public. That picture, captured on a silver-coated sheet of copper, using his ' positive image. The word photography was first used in the year 1839. By the time the detai...
franklyspeakingvintagegreetings.blogspot.com
Frankly Speaking Modern Vintage Blogspot: September 2010
http://franklyspeakingvintagegreetings.blogspot.com/2010_09_01_archive.html
Remixing, remaking, and recycling great vintage imagery. Saturday, September 25, 2010. These might make you think. I believe in equality for everyone, except reporters and. People are pretty much alike. It's only that our differences are more susceptible to definition than our similarities. All the people like us are we, and everyone else is They. Tell the children the truth. Is the acceptance or promotion of multiple ethnic. Links to this post. Friday, September 24, 2010. Do I really care? I just love t...
franklyspeakingvintagegreetings.blogspot.com
Frankly Speaking Modern Vintage Blogspot: and on this day...88 years ago!
http://franklyspeakingvintagegreetings.blogspot.com/2011/11/and-on-this-day88-years-ago.html
Remixing, remaking, and recycling great vintage imagery. Sunday, November 20, 2011. And on this day.88 years ago! Morgan, the child of two former slaves, was born in Kentucky. In 1877. When he was just 14 years old, he moved north to Ohio. Subscribe to: Post Comments (Atom). Here's a vintage remix! Frankly Speaking Vintage Greetings. And on this day.88 years ago! Here Come the Holidays! Frankly Speaking on Facebook. Los Angeles, CA, United States. Julie and I are sister-in-laws and best friends and we we...
franklyspeakingvintagegreetings.blogspot.com
Frankly Speaking Modern Vintage Blogspot: We love vintage doors!
http://franklyspeakingvintagegreetings.blogspot.com/2011/10/we-love-vintage-doors.html
Remixing, remaking, and recycling great vintage imagery. Thursday, October 27, 2011. We love vintage doors! There is something about old doors! To begin with doors are the gateway to every home, building.you have to pass through to see what's in side. Don't you sometimes walk by a door and wonder what's inside? Lot's of photographers like to take pictures of doors around the world and we thought we might share some beauties with you! This is a crazy old door.it's old and a. Little below the sidewalk.
franklyspeakingvintagegreetings.blogspot.com
Frankly Speaking Modern Vintage Blogspot: October 30, 1938...broadcasting history!
http://franklyspeakingvintagegreetings.blogspot.com/2011/10/october-30-1938broadcasting-history.html
Remixing, remaking, and recycling great vintage imagery. Sunday, October 30, 2011. October 30, 1938.broadcasting history! The original War of the Worlds was broadcast on this day.October 30, 1938. Subscribe to: Post Comments (Atom). Here's a vintage remix! Frankly Speaking Vintage Greetings. October 30, 1938.broadcasting history! We love vintage doors! All the old shoes are new again! Frankly Speaking on Facebook. Los Angeles, CA, United States. View my complete profile. Vintage (& more) inspiring blogs.
franklyspeakingvintagegreetings.blogspot.com
Frankly Speaking Modern Vintage Blogspot: December 2010
http://franklyspeakingvintagegreetings.blogspot.com/2010_12_01_archive.html
Remixing, remaking, and recycling great vintage imagery. Tuesday, December 21, 2010. Julie and I've been so busy that we just haven't been on the blog lately.sorry about that! So today, I think instead of writing lot's of stuff.I am going to give you lot's of holiday season flashes from your past.hope you enjoy. Lot's of wonderful baking from your oven! And now some of us do like fruitcake! Must have been someone's Grandma's. Gorgeous vintage Menorah from the turn of the century. They were our parents.
franklyspeakingvintagegreetings.blogspot.com
Frankly Speaking Modern Vintage Blogspot: October 2010
http://franklyspeakingvintagegreetings.blogspot.com/2010_10_01_archive.html
Remixing, remaking, and recycling great vintage imagery. Tuesday, October 26, 2010. Everything you want to know about animal crackers! Animal Crackers in your soup. And how do you say animal crackers in your soup in Japanese? And they are good for you! Let's get this party rolling! Was added in September 2002 after being chosen by consumer votes, beating out the penguin, walrus and cobra. Some of Barnum's Animals. To celebrate its 100th anniversary, Barnum's added the koala. Links to this post. 65279;...
franklyspeakingvintagegreetings.blogspot.com
Frankly Speaking Modern Vintage Blogspot: October 2011
http://franklyspeakingvintagegreetings.blogspot.com/2011_10_01_archive.html
Remixing, remaking, and recycling great vintage imagery. Sunday, October 30, 2011. October 30, 1938.broadcasting history! The original War of the Worlds was broadcast on this day.October 30, 1938. Thursday, October 27, 2011. We love vintage doors! There is something about old doors! To begin with doors are the gateway to every home, building.you have to pass through to see what's in side. Don't you sometimes walk by a door and wonder what's inside? This is a crazy old door.it's old and a. These french do...
TOTAL LINKS TO THIS WEBSITE
11
franklyspeakingtoastmasters.org
Frankly Speaking Toastmasters Club
It looks like you do not appear to have JavaScript enabled in your browser and this website requires. It to be enabled. Click the following link for instructions on enabling Javascript: http:/ www.enable-javascript.com/. Where Leaders Are Made. FreeToastHost Website Support is available at: http:/ support.toastmastersclubs.org. Frankly Speaking Toastmasters Club. Meeting Information / Directions. For more information on Toastmasters International, visit toastmasters.org. Login as site admin. Through its ...
Coming Soon - Future home of something quite cool
Future home of something quite cool. If you're the site owner. To launch this site. If you are a visitor. Please check back soon.
franklyspeakingtoo.blogspot.com
Frankly Speaking Too
Thursday, June 20, 2013. Teacher/Parent Appreciation: Class Projects. Here are a pair of projects that I used this year for my daughter's class. I took a few chalkboards to school and took two photos of each child: one telling what their favorite subject their teacher taught them and one telling what they want to be when they grow up. I used the first for teacher appreciation week. I printed this as an 11x14 and framed it. Fun little keepsakes for both the parents and the teachers! Tuesday, June 18, 2013.
franklyspeakingtv.wordpress.com
FranklySpeakingTV | Just another WordPress.com weblog
Verizon and Google Working on Tablet. May 12, 2010 at 5:36 pm. Google Book Store Coming Soon. May 5, 2010 at 6:36 pm. Apple Sold A Million iPads. May 3, 2010 at 6:43 pm. Is it Worth Getting the Ipad 3g? April 30, 2010 at 1:10 pm. New Call of Duty to be Unveiled Friday. It won’t be easy but the COD franchise has yet to disappoint. I’m sure with the release of this new Call Of Duty it won’t be any different. April 29, 2010 at 2:52 pm. Gizmodo Editor in Hot Water. April 27, 2010 at 3:52 pm. Watch Frankly Sp...
franklyspeakingvintagegreetings.blogspot.com
Frankly Speaking Modern Vintage Blogspot
Remixing, remaking, and recycling great vintage imagery. Sunday, November 20, 2011. And on this day.88 years ago! Morgan, the child of two former slaves, was born in Kentucky. In 1877. When he was just 14 years old, he moved north to Ohio. Links to this post. Tuesday, November 8, 2011. Here Come the Holidays! Vintage images can be so much fun for the holidays! And, we admit it, poke a little fun at some of the goings-on of the festive season! You do know what a bundt is, don't you? When we found these ol...
franklyspeakingvintagegreetings.com
HomeFrankly Speaking Vintage Greeting Cards
Our greeting cards pair up nostalgic images with fun quotes for a modern, quirky style! Retailers can buy most items in sets of 3 or 6 with just a $50 minimum. See details on the Wholesale page. FRANKLY SPEAKING VINTAGE GREETINGS! Mom and Dad Day.
Frankly Speeching
Software for TM Clubs. Mobile Demo" 1:10 mins. Tip: improve the quality of the video by clicking the 'gear' symbol and select '720p'. 2:26 mins, " Full Membership Demo. 2:39 mins, " FreeRSVP Intro. 3:39 mins, " FreeRSVP Demo. Select your club -. Remember (only login once):. Would you like to try? Anytime, Anywhere you have internet. RSVP, Confirm or Claim in 12 seconds. Japanese and English, PC and mobile. Track speaking and leadership progress. Create an agenda in 1 minute. Assign roles by VPE or TME.
dewdrops
Tuesday, January 5, 2010. ITS ABOUT YOUR CO-LIVINGS. What do you think the severe of all problem the world faces today? Answers will vary with the perspectives each one have. The fact is this, whatever you find as problem- only by identifying this as a problem you are commited to do something for that ,do you? Think of these issue BIG .BBC reported that. With 2015 number of starving million. Atleast remeber them in your prayer. Sunday, January 3, 2010. But pause a moment and try to be with me a miment.
FRANKLY SPKING
TO BE HONEST MAGAZINE. Corner Magazine 7 Times Aussies Did it Better. Corner Magazine Bone Daddies, AKA the Mac Daddy of Ramen. Corner Magazine LC:M Daily Outfit Suggestions. Superdry and British Fashion Council London Collections: Men AW15. Corner Magazine 2015 Fashion Resolutions: The Ten Commandments. How to: Woo the Pants Off Any Woman. How to: Have the Best Christmas in London. How to: Rebel Without a Cause. The Top 10 Girl Top 10 Ways to Bring the Zen. Follow “FRANKLY SPKING”.
Price Request - BuyDomains
Url=' escape(document.location.href) , 'Chat367233609785093432', 'toolbar=0,scrollbars=0,location=0,statusbar=0,menubar=0,resizable=0,width=640,height=500');return false;". Need a price instantly? Just give us a call. Toll Free in the U.S. We can give you the price over the phone, help you with the purchase process, and answer any questions. Get a price in less than 24 hours. Fill out the form below. One of our domain experts will have a price to you within 24 business hours. United States of America.
frankly spoken - Schrijfbedrijf voor tekst en coaching
